PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G0401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 424aa    MW: 47235.4 Da    PI: 8.7869
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G0401genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.3e-40144221178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +C v++C++dls++++yhrrhkvCe hsk+++v+++gl+qrfCqqCsrfh+l+efD++krsCr rL++hn+rrrk+q+
  Gh_D11G0401 144 VCLVDECNTDLSNCRDYHRRHKVCELHSKTAEVMINGLKQRFCQQCSRFHSLEEFDNGKRSCRARLDRHNRRRRKPQP 221
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-32140206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.684142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37143224IPR004333Transcription factor, SBP-box
PfamPF031103.9E-30145218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MESLSVIQWL EKRRQLFLFV CNCNCNFILG ENSRKKLNKQ GVEVKGFLIL MDWNLKATSG  60
DFTEFVQETV STADTDIING NESNSYKLVN SIGDFRVDLK LGQVGNSGEL PSNKWKEPRV  120
LKMESSSSSS KKFRPTNIGT HPVVCLVDEC NTDLSNCRDY HRRHKVCELH SKTAEVMING  180
LKQRFCQQCS RFHSLEEFDN GKRSCRARLD RHNRRRRKPQ PDPLSHSRSY FSNYQGSQML  240
PFSGLQVYPS TSVVKTTWPE SRYLNLKQPP AKQNLLLGSS SSNYREGKQQ CSFLQGKNQT  300
PAKASICQPV LGGVAPFSEG NGGCQSMLCD RLTTQVRDSD CALSLLSSPL LHTSGIGLSN  360
MVQPQSFPLV QSLGPSLQDH IIEPMGSVIA NGRETTVHGS GMFHMGSGGS SASEPPENLG  420
FNWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-271442181084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201218KRSCRARLDRHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.25690.0ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223260.0KJ622326.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489021.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_012489022.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_012489023.10.0PREDICTED: squamosa promoter-binding-like protein 13A
TrEMBLA0A0D2P2W60.0A0A0D2P2W6_G
STRINGPOPTR_0015s11100.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-56SBP family protein